PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400050209
Common NameLOC102605648
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 550aa    MW: 60480.2 Da    PI: 7.0919
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400050209genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.54.3e-31190246259
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           +DgynWrKYGqK vkg+ef+rsYY+Ct+++C +kk+vers+ d+++++i+Y g+H+h+
  PGSC0003DMP400050209 190 EDGYNWRKYGQKLVKGNEFTRSYYKCTFPNCLAKKQVERSH-DGHITDIHYIGKHEHP 246
                           7****************************************.***************8 PP

2WRKY99.91.6e-31368425259
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           +Dg +WrKYGqK vkg+++prsYYrC+ agCpvkk+ver+++dpk+v++tYeg+H h+
  PGSC0003DMP400050209 368 NDGQRWRKYGQKIVKGNPNPRSYYRCSVAGCPVKKHVERASHDPKLVITTYEGQHVHD 425
                           8*******************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081121.62184248IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.9E-26185246IPR003657WRKY domain
SuperFamilySSF1182902.75E-24187246IPR003657WRKY domain
SMARTSM007742.6E-34189247IPR003657WRKY domain
PfamPF031061.6E-23190246IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.9E-34353427IPR003657WRKY domain
SuperFamilySSF1182903.66E-28359427IPR003657WRKY domain
PROSITE profilePS5081134.773362427IPR003657WRKY domain
SMARTSM007742.3E-36367426IPR003657WRKY domain
PfamPF031064.7E-25368424IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MGTPKEEATD EVFSENLEQK PDPDSATRKL ELKADVVSGE LQKRLSQCDK GINVSQSNQE  60
AISLSRVQEN QPEYVQKQQG VKSEADASGS SQLSSLPKDS DAKSCGSESS VKDKVVSVLS  120
GKASDSSDQM RSSNMEVFVS QSDLQRVSYT IKREKALDKL QPRRNPDTSA HGLMSDQGTT  180
LLKAPEKPSE DGYNWRKYGQ KLVKGNEFTR SYYKCTFPNC LAKKQVERSH DGHITDIHYI  240
GKHEHPETLS VPQMSPEYVL PLQMKRPDIP IITALEAEGE KSSTPRETCE PSKPSEAPLA  300
LDIVSACDSV KVTPLKRHKL ENEVDKGDGQ DSKKQKKDTV ATDDTPPIKS HSEPRHIVQT  360
VSEVDIINDG QRWRKYGQKI VKGNPNPRSY YRCSVAGCPV KKHVERASHD PKLVITTYEG  420
QHVHDFPTSR AISQISVAPD AGTADIREDS RIESGEKKHV VESKTESGET KHIRESKTEA  480
SENKHVKESK AKSGENKHVG ESKTESGGNK HAGESKPELG GNKHVGESIP ESGENKHVGL  540
DMAVHIGAN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-32190427877Probable WRKY transcription factor 4
2lex_A8e-32190427877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3134520.0AF313452.1 Solanum dulcamara thermal hysteresis protein STHP-64 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006352011.10.0PREDICTED: WRKY transcription factor 1-like
TrEMBLM1CT960.0M1CT96_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000741570.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45582242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.12e-69WRKY family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]